} } }); { "actions" : [ "context" : "", "eventActions" : [ Konto aufladen, damit man mindestens 29,95€ verfügbar hat. "context" : "", Denn zu einem vielleicht knapperen Budget passt ein Tarif ohne vertragliche Bindung. }, var key = e.keyCode; ","loaderSelector":"#lineardisplaymessageviewwrapper_5 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); window.location = "https://forum.vodafone.de/t5/CallYa/Callya-Digital-k%C3%BCndigen/td-p/2058527" + "/page/" + val; LITHIUM.StarRating('#any_10', false, 1, 'LITHIUM:starRating'); setWarning(pagerId); "actions" : [ }, "disableLinks" : "false", { { }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "initiatorBinding" : true, "actions" : [ } } "initiatorBinding" : true, ] "actions" : [ /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { }, { "initiatorBinding" : true, { "actions" : [ { "context" : "", "action" : "rerender" LITHIUM.StarRating('#any_7', false, 1, 'LITHIUM:starRating'); "event" : "removeThreadUserEmailSubscription", "context" : "envParam:quiltName,message,product,contextId,contextUrl", ', 'ajax'); }, { { "initiatorDataMatcher" : "data-lia-message-uid" { { "context" : "", ', 'ajax'); LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'AfXRNC6ym5Q-g1KY8o8RxSF10Qo06nzVdCpeVnYqsH8. }, "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ } "action" : "rerender" "context" : "envParam:quiltName,product,contextId,contextUrl", } "event" : "QuickReply", } { ] { ] }, LITHIUM.AjaxSupport.ComponentEvents.set({ { "action" : "addClassName" { { ] "event" : "MessagesWidgetAnswerForm", } ] We are the best SEO service provider in Worldwide. { "event" : "kudoEntity", "kudosLinksDisabled" : "false", "forceSearchRequestParameterForBlurbBuilder" : "false", }, { } "action" : "rerender" ] ], } { "context" : "", } "actions" : [ "event" : "approveMessage", { ;(function($) { }, { }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_25","feedbackSelector":".InfoMessage"}); "context" : "", "event" : "MessagesWidgetEditAnswerForm", "message" : "2059191", ] "action" : "rerender" { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/CallYa/thread-id/84596","ajaxErrorEventName":"LITHIUM:ajaxError","token":"qYN57EujPG491FXOKvevZlKBtGLvRikqJjIIxFfAxho. "context" : "", "actions" : [ "event" : "ProductAnswer", "; LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); "componentId" : "kudos.widget.button", "event" : "ProductAnswerComment", }, ] "displaySubject" : "true", "actions" : [ "action" : "rerender" "actions" : [ "event" : "addMessageUserEmailSubscription", "action" : "rerender" "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "actions" : [ LITHIUM.MessageBodyDisplay('#bodyDisplay_8', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { } { "parameters" : { "action" : "rerender" "actions" : [ "componentId" : "kudos.widget.button", "eventActions" : [ "componentId" : "forums.widget.message-view", "context" : "envParam:selectedMessage", ], "event" : "expandMessage", $(this).next().toggle(); } }, }); "context" : "envParam:feedbackData", }); } { { { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "displaySubject" : "true", "context" : "", } "truncateBody" : "true", "event" : "expandMessage", LITHIUM.Dialog.options['-1644067994'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; { { } { } } } "message" : "2058786", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2058883 .lia-rating-control-passive', '#form_5'); ] ] "event" : "ProductAnswer", "event" : "MessagesWidgetCommentForm", "context" : "", "showCountOnly" : "false", "action" : "rerender" "context" : "", "event" : "ProductMessageEdit", { "accessibility" : false, "action" : "rerender" "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "rerender" if (isNaN(val) ) "event" : "removeMessageUserEmailSubscription", "actions" : [ "event" : "deleteMessage", "action" : "rerender" "event" : "MessagesWidgetEditAction", }, { { "actions" : [ }, } "actions" : [ { }, /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ }, } "action" : "pulsate" "actions" : [ "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", } LITHIUM.AjaxSupport.fromLink('#kudoEntity_9', 'kudoEntity', '#ajaxfeedback_9', 'LITHIUM:ajaxError', {}, 'DjNQ00mF4AnIj0jc-gJImyI1nxWoemY-VACpqGeSD_M. }, { "displaySubject" : "true", "action" : "rerender" { "kudosable" : "true", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { }, ] var keycodes = { { "kudosLinksDisabled" : "false", "context" : "envParam:quiltName", }); '; "selector" : "#messageview_7", } "action" : "rerender" "componentId" : "forums.widget.message-view", Bist du sicher, dass du fortfahren möchtest? "useTruncatedSubject" : "true", "context" : "envParam:quiltName", "message" : "2059176", LITHIUM.Dialog.options['-1304044065'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_19","feedbackSelector":".InfoMessage"}); $(document).ready(function(){ })(LITHIUM.jQuery); "actions" : [ } $('#vodafone-community-header .lia-search-input-wrapper').hide(); // enable redirect to login page when "logmein" is typed into the void =) LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_27","feedbackSelector":".InfoMessage"}); LITHIUM.AjaxSupport.fromLink('#kudoEntity_7', 'kudoEntity', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {}, 'gdihBfuMWmzbSymEn2Wh8KXiKLdmTpWUt0IeFZwzzEI. "actions" : [ { Erstelle eine Vodafone Kündigung kostenlos mit unserer Muster Vorlage. LITHIUM.Dialog.options['1498468873'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"}); { "event" : "ProductMessageEdit", "event" : "MessagesWidgetMessageEdit", { } } "event" : "QuickReply", }, ] "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "rerender" "event" : "MessagesWidgetMessageEdit", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "revokeMode" : "true", { }, "context" : "envParam:quiltName,message", "linkDisabled" : "false" "messageViewOptions" : "1111110111111111111110111110100101001101" $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); ] "context" : "envParam:quiltName,expandedQuiltName", ] } "disableLabelLinks" : "false", "action" : "rerender" }, "event" : "ProductMessageEdit", "messageViewOptions" : "1111110111111111111110111110100101001101" } { "quiltName" : "ForumMessage", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "selector" : "#messageview_5", "actions" : [ }, "context" : "envParam:quiltName", return false; ] "context" : "envParam:quiltName,product,contextId,contextUrl", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_44","feedbackSelector":".InfoMessage"}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_54","feedbackSelector":".InfoMessage"}); document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div"); }, { "event" : "approveMessage", "action" : "rerender" }, { "context" : "", "actions" : [ "actions" : [ "context" : "envParam:feedbackData", } ] ] LITHIUM.StarRating('#any_0_8', true, 2, 'LITHIUM:starRating'); { } } ], "actions" : [ "action" : "rerender" "event" : "unapproveMessage", { ] "actions" : [ { { "action" : "rerender" { }); { "event" : "ProductMessageEdit", } document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no warning"); { "event" : "MessagesWidgetAnswerForm", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown","menuItemsSelector":".lia-menu-dropdown-items"}}); }, "kudosable" : "true", } { "actions" : [ LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_4","componentSelector":"#lineardisplaymessageviewwrapper_4","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2058875,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); LITHIUM.StarRating('#any_4', false, 1, 'LITHIUM:starRating'); { }, ;(function($) { "action" : "rerender" "event" : "QuickReply", }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_45","feedbackSelector":".InfoMessage"}); "context" : "", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_6","menuItemsSelector":".lia-menu-dropdown-items"}}); "actions" : [ "actions" : [ { "context" : "", "action" : "rerender" "actions" : [ { } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ "useTruncatedSubject" : "true", "action" : "rerender" } "event" : "ProductAnswer", "action" : "rerender" "actions" : [ "useCountToKudo" : "false", createStorage("true"); } ] }, "event" : "markAsSpamWithoutRedirect", "action" : "rerender" "actions" : [ { "action" : "rerender" "initiatorBinding" : true, clearWarning(pagerId); "action" : "rerender" "parameters" : { "event" : "addMessageUserEmailSubscription", "actions" : [ } function doChecks(pagerId, val) { "initiatorBinding" : true, $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); if ( !watching ) { }, } } "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "MessagesWidgetAnswerForm", }, }, }, }); "actions" : [ LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); "event" : "removeMessageUserEmailSubscription", } } ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); ] ] "truncateBodyRetainsHtml" : "false", }, { "actions" : [ }, }, "disableKudosForAnonUser" : "false", ] clearWarning(pagerId); { } { } }, }, }, "; window.location = "https://forum.vodafone.de/t5/CallYa/Callya-Digital-k%C3%BCndigen/td-p/2058527" + "/page/" + val; }, { "selector" : "#messageview_9", }, }, ] "event" : "deleteMessage", }); ] } }, "context" : "lia-deleted-state", "actions" : [ "initiatorDataMatcher" : "data-lia-message-uid" { } { "parameters" : { { }); "action" : "rerender" ","loaderSelector":"#lineardisplaymessageviewwrapper_7 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); }, { "showCountOnly" : "false", "event" : "MessagesWidgetCommentForm", } "selector" : "#messageview_3", "context" : "", { "context" : "lia-deleted-state", "; resetMenu(); "event" : "editProductMessage", } "context" : "", "actions" : [ { "componentId" : "kudos.widget.button", }, "context" : "", "forceSearchRequestParameterForBlurbBuilder" : "false", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "event" : "MessagesWidgetEditAnswerForm", "}); }); LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; }, { "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_43","feedbackSelector":".InfoMessage"}); }, { } "context" : "envParam:quiltName,message,product,contextId,contextUrl", if ( Number(val) < 1 ) "displayStyle" : "horizontal", "actions" : [ "action" : "rerender" "actions" : [ "displaySubject" : "true", { }, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_6","componentSelector":"#lineardisplaymessageviewwrapper_6","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2059176,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. ] "action" : "rerender" "event" : "deleteMessage", { "context" : "envParam:selectedMessage", "event" : "RevokeSolutionAction", } }, }, ] "initiatorBinding" : true, count++; "action" : "rerender" "action" : "rerender" "event" : "expandMessage", ] .attr('aria-expanded','false'); "context" : "", "action" : "rerender" }, "event" : "AcceptSolutionAction", if ( watching ) { "componentId" : "forums.widget.message-view", "useTruncatedSubject" : "true", { "componentId" : "kudos.widget.button", }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_52","feedbackSelector":".InfoMessage"}); { })(LITHIUM.jQuery); ] "actions" : [ { ] } { } "context" : "envParam:quiltName,message", "event" : "kudoEntity", } "; var o = document.getElementById("custom_board_pagination_warning" + pagerId); } }, "message" : "2059442", "initiatorBinding" : true, }, { LITHIUM.StarRating('#any_0_8', true, 2, 'LITHIUM:starRating'); "event" : "addMessageUserEmailSubscription", }, // We're good so far. { "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_52","feedbackSelector":".InfoMessage"}); ] { "; } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "deleteMessage", "action" : "rerender" ], ] { ], "actions" : [ "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", ] setWarning(pagerId); "actions" : [ ] }, { document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no warning"); Handyvertrag Prepaid kündigen. "actions" : [ { "context" : "envParam:quiltName", { }, }, { "event" : "ProductAnswer", "event" : "markAsSpamWithoutRedirect", "initiatorBinding" : true, "action" : "rerender" }, "event" : "removeThreadUserEmailSubscription", "context" : "", "event" : "unapproveMessage", { if ( count == neededkeys.length ) { }, { } { "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_52","feedbackSelector":".InfoMessage"}); { // Set start to true only if the first key in the sequence is pressed } { "context" : "", "context" : "", "context" : "envParam:entity",